PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.0635s0026.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family HB-other
Protein Properties Length: 876aa    MW: 97285.7 Da    PI: 9.9098
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.0635s0026.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox18.14.7e-062480157
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         +r+R  ++++ ++ L+++F+ +  +s++e +e+++  g+t +qV+ +F  ++++ ++
  Cagra.0635s0026.1.p 24 KRPRDLLNPKAVKYLQAVFAVKDAISKRESREISALFGITVAQVREFFVTQKTRVRR 80
                         799*********************************************999999886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.6532181IPR001356Homeobox domain
SuperFamilySSF466898.55E-62283IPR009057Homeodomain-like
SMARTSM003898.5E-52385IPR001356Homeobox domain
CDDcd000860.001282481No hitNo description
Gene3DG3DSA:1.10.10.601.4E-42483IPR009057Homeodomain-like
Gene3DG3DSA:1.20.930.101.7E-4186280IPR017923Transcription factor IIS, N-terminal
SuperFamilySSF476763.92E-5189282IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 876 aa     Download sequence    Send to blast
MIQTLLHNLI ASLAAGALSI NIGKRPRDLL NPKAVKYLQA VFAVKDAISK RESREISALF  60
GITVAQVREF FVTQKTRVRR QVRLSREKVI LSNTDALQGD GVPEDNNGTN HVDPVPLNSI  120
HPEACSISWS AAETVALIPP EDIPPDISDS DKYFVENIFA LLRKEESFSG QVKLMEWIMQ  180
IQDSSVLIWF LSKGGVLILT TWLSQAAVEE QTSVILLILK VLCHLPLHKA SPENMSAILQ  240
SVNGLRFYRT SDISNRAKGL LSRWTKLFAK IQAMKKQNRN NSQIDSQSQL LLKQSIAEIM  300
GDSSNPEDIL SLSNGRSENV RRFESSQGPK LLLTSADDST KKHMLGSTPS YNKERRKVQM  360
VEQPGQKAAG KSPQTVRIGT SSRSRPMSAD DIQKAKMRAL FMQSKNSKKD PLPSAIGDSR  420
TIVPEKPLAL ESSKDFPPSQ NNEAKTEDTY VPLAVQPVNG PAVIVKVQAD EIKKPLTPPK  480
SISSKVGILV KMSPQTILKN CKRKQIDWHV PPGMVLDEVW RVATGGNSKE ADVQRNRNRR  540
ERETTYQSLQ TIPLNPKEPW DREMDFDDTL TPEIPSQQPP DESITEPQNS LDERRTAASA  600
ATTSSSLSSP EPDLELLAAL LKNPDLVYAL TSGKPSNLAG QDMVKLLDVI KTGAPNSSSS  660
SNKQSEEKVE VSLPSPTPST NPGMSGWGQE AIRNPFSRQK QVGAPVARLV TQHHVTNSMQ  720
WQSTNEQAIP RHATAAYNNS LILPHTERQQ QQHMQPQLHH NHHLQQQPMS TTSYGVREPV  780
GQMGTATLGS WRLQQSQNSY YSHQANDVAS VSQSSSYQGN NQYMSSSNPG YESWSPDHSP  840
SRNHPNIRGG QQQQQPSRKH DSSSHPYWNQ NKRWR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2267460.0AK226746.1 Arabidopsis thaliana mRNA for luminidependens protein, complete cds, clone: RAFL07-75-C15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006289646.10.0hypothetical protein CARUB_v10003204mg
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLR0H0240.0R0H024_9BRAS; Uncharacterized protein
STRINGscaffold_604015.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein